PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G382300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 571aa    MW: 61606.2 Da    PI: 9.4152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G382300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-1766112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEde l +av+ + g++Wk+Ia+ +   Rt+ qc +rwqk+l
  Sevir.5G382300.1.p  66 KGGWTPEEDETLRKAVETFKGRNWKKIAEFFH-DRTEVQCLHRWQKVL 112
                         688*****************************.************986 PP

2Myb_DNA-binding61.32e-19118164148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd++++d+v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
  Sevir.5G382300.1.p 118 KGPWTQEEDDKIIDLVRKYGPTKWSIIAKSLP-GRIGKQCRERWHNHL 164
                         79******************************.*************97 PP

3Myb_DNA-binding58.91.2e-18170213146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +++WT+eE+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.5G382300.1.p 170 KDAWTPEEERALINAHRVHGNK-WAEIAKALP-GRTDNSIKNHWNS 213
                         679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.961112IPR017930Myb domain
SuperFamilySSF466891.58E-1863126IPR009057Homeodomain-like
SMARTSM007171.1E-1465114IPR001005SANT/Myb domain
PfamPF002492.3E-1566112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2368124IPR009057Homeodomain-like
CDDcd001671.50E-1369112No hitNo description
PROSITE profilePS5129432.539113168IPR017930Myb domain
SuperFamilySSF466894.77E-32115211IPR009057Homeodomain-like
SMARTSM007171.8E-18117166IPR001005SANT/Myb domain
PfamPF002492.2E-18118164IPR001005SANT/Myb domain
CDDcd001671.90E-16120164No hitNo description
Gene3DG3DSA:1.10.10.603.7E-27125171IPR009057Homeodomain-like
PROSITE profilePS5129423.808169219IPR017930Myb domain
SMARTSM007177.7E-18169217IPR001005SANT/Myb domain
PfamPF002497.0E-17170213IPR001005SANT/Myb domain
CDDcd001672.04E-14172215No hitNo description
Gene3DG3DSA:1.10.10.602.4E-24172219IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MMGAMAEVVQ EGCVENRQPL AASSSSVSDG SSCGGGGPAG TSPLVSSSGN SISGLRRTSG  60
PIRRAKGGWT PEEDETLRKA VETFKGRNWK KIAEFFHDRT EVQCLHRWQK VLNPELIKGP  120
WTQEEDDKII DLVRKYGPTK WSIIAKSLPG RIGKQCRERW HNHLNPEIRK DAWTPEEERA  180
LINAHRVHGN KWAEIAKALP GRTDNSIKNH WNSSLRKRLD AYGANSFLAA QNLLAHDDFK  240
DQMRPIAMGN RLDLNKVPII GSKDVPGRAH RSIIGSLSQA YNLKDSSAFL SLSIPTAQTS  300
YEMSSLVDGS AVTLAAQGLE SDSVRGKGLE IDSLHEKGFE VSSTPDPVGK GCAIQLKSAP  360
AKSGTKSSLK NELYSTLGPL CYQIPNMEEV APISSSLHSE NHGSHQTTHH SKDGLKSPDG  420
FTSPSPTIGK VSSPLTVDSI LKTAADSFPC TPSILRKRKR DKSTPTSDNE LKMGGVNTDS  480
FYTPNGKGAS TNTPGSFKTA LLSLGPLDGL LTSVRSSDAS PPYQIRSKRM AAMKSVEKQL  540
DFSADGLDTS GSEILNSPCH NSQGANSNRT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-73652195159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-73652195159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1455461RKRKRDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970536.10.0PREDICTED: uncharacterized protein LOC101760031
TrEMBLK3XG230.0K3XG23_SETIT; Uncharacterized protein
STRINGSi000842m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-108myb domain protein 3r-5